SCOPe 2.06: Domain d4x04a1: 4x04 A:28-327

Lineage for d4x04a1 (4x04 A:28-327)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Citrobacter koseri [TaxId:290338] [267974] (2 PDB entries)

8. Domain d4x04a1: 4x04 A:28-327 [267585]
   Other proteins in same PDB: d4x04a2, d4x04b2, d4x04c2, d4x04d2
   automated match to d4mija_
   complexed with bdp, cl, mg

Details for d4x04a1

PDB Entry: 4x04, 2.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate

PDB Compounds: (A:) solute binding protein

SCOPe Domain Sequences for d4x04a1:

Sequence; same for both SEQRES and ATOM records:

>d4x04a1 c.94.1.0 (A:28-327) automated matches {Citrobacter koseri [TaxId: 290338]}
qvikaadvhpqgypnvvavqkmgeklkqqtdgkleikvfpggvlgdekqmieqaqigaid
mirvsmapvaailpdievftlpyvfrdedhmhkiidgdigksigdkltnnpksrlvflgw
mdsgtrnlitknpvekpedlhgmkirvqgspvaldtlkdmgansvamgvsevfsgmqtgv
idgaennpptfvahnympvaknytlsghfitpemllyskvkwdkltadeqqkiltlarea
qfeqrklwdaynqealakmkaggvqfheidkayfvkatepvraqygekhqalmkaiadvq

Timeline for d4x04a1:

• d4x04a1 first appeared in SCOPe 2.05, called d4x04a_
  
• d4x04a1 appears in SCOPe 2.07
  
• d4x04a1 appears in the current release, SCOPe 2.08