![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins) |
![]() | Protein TRAP dicarboxylate transporter [267666] (2 species) |
![]() | Species Polaromonas [TaxId:296591] [267752] (1 PDB entry) |
![]() | Domain d4mija_: 4mij A: [266737] complexed with ada, cl, edo, gtr |
PDB Entry: 4mij (more details), 1.1 Å
SCOPe Domain Sequences for d4mija_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mija_ c.94.1.1 (A:) TRAP dicarboxylate transporter {Polaromonas [TaxId: 296591]} tefrsadthnaddyptvaavkymgellekksggkhkikvfnkqalgseketidqvkigal dftrvnvgpmnaicpltqvptmpflfssiahmrksldgpvgdeilkscesagfiglafyd sgarsiyakkpirtvadakglkirvqqsdlwvalvsamganatpmpygevytglktglid aaennipsfdtakhveavkvysktehsmapeilvmskiiydklpkaeqdmiraaakesva ferqkwdeqeakslanvkaagaeivevdkksfqavmgpvydkfmttpdmkrlvkavqdtk ae
Timeline for d4mija_: