Lineage for d1ytha_ (1yth A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61254Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 61552Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 61553Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (10 PDB entries)
  8. 61559Domain d1ytha_: 1yth A: [26752]

Details for d1ytha_

PDB Entry: 1yth (more details), 2.2 Å

PDB Description: siv protease crystallized with peptide product

SCOP Domain Sequences for d1ytha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytha_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

SCOP Domain Coordinates for d1ytha_:

Click to download the PDB-style file with coordinates for d1ytha_.
(The format of our PDB-style files is described here.)

Timeline for d1ytha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ythb_