PDB entry 1yth

View 1yth on RCSB PDB site
Description: siv protease crystallized with peptide product
Deposited on 1996-08-01, released 1997-03-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ytha_
  • Chain 'B':
    Domains in SCOP 1.57: d1ythb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ythA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ythB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf