SCOP 1.59: Domain d1ytha_: 1yth A:

Lineage for d1ytha_ (1yth A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)

8. Domain d1ytha_: 1yth A: [26752]

Details for d1ytha_

PDB Entry: 1yth, 2.2 Å

PDB Description: siv protease crystallized with peptide product

SCOP Domain Sequences for d1ytha_:

Sequence; same for both SEQRES and ATOM records:

>d1ytha_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1ytha_:

• d1ytha_ first appeared (with stable ids) in SCOP 1.55
  
• d1ytha_ appears in SCOP 1.57
  
• d1ytha_ appears in SCOP 1.61
  
• d1ytha_ appears in the current release, SCOPe 2.08