Lineage for d4qaae1 (4qaa E:1-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819576Protein automated matches [190922] (2 species)
    not a true protein
  7. 2819577Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)
  8. 2819806Domain d4qaae1: 4qaa E:1-205 [267285]
    Other proteins in same PDB: d4qaaa2, d4qaab2, d4qaac2, d4qaad2, d4qaae2, d4qaaf2, d4qaag2, d4qaah2, d4qaai2, d4qaaj2
    automated match to d4alxa_
    complexed with kk1, nag, po4

Details for d4qaae1

PDB Entry: 4qaa (more details), 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with 6-(4-methoxyphenyl)-n4-octylpyrimidine-2,4-diamine
PDB Compounds: (E:) acetylcholine-binding protein

SCOPe Domain Sequences for d4qaae1:

Sequence, based on SEQRES records: (download)

>d4qaae1 b.96.1.1 (E:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d4qaae1 b.96.1.1 (E:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptsddseyfsqysrfeildvtqkknsv
teayedvevslnfrkkg

SCOPe Domain Coordinates for d4qaae1:

Click to download the PDB-style file with coordinates for d4qaae1.
(The format of our PDB-style files is described here.)

Timeline for d4qaae1: