Lineage for d4ojnd2 (4ojn D:161-332)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232608Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (16 PDB entries)
  8. 2232662Domain d4ojnd2: 4ojn D:161-332 [267061]
    Other proteins in same PDB: d4ojna1, d4ojna3, d4ojnb1, d4ojnc1, d4ojnc3, d4ojnd1, d4ojnd3, d4ojne1, d4ojnf1, d4ojng1, d4ojnh1
    automated match to d4l4ra2
    complexed with 1pe, gol

Details for d4ojnd2

PDB Entry: 4ojn (more details), 2.4 Å

PDB Description: Crystal structure of human muscle L-lactate dehydrogenase
PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ojnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ojnd2 d.162.1.1 (D:161-332) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4ojnd2:

Click to download the PDB-style file with coordinates for d4ojnd2.
(The format of our PDB-style files is described here.)

Timeline for d4ojnd2: