Lineage for d4ei2h2 (4ei2 H:245-336)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2241850Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 2241851Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 2241882Family d.286.1.0: automated matches [228502] (1 protein)
    not a true family
  6. 2241883Protein automated matches [228504] (1 species)
    not a true protein
  7. 2241884Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)
  8. 2241916Domain d4ei2h2: 4ei2 H:245-336 [266206]
    Other proteins in same PDB: d4ei2a1, d4ei2a3, d4ei2b1, d4ei2c1, d4ei2c3, d4ei2d1, d4ei2d3, d4ei2e1, d4ei2e3, d4ei2f1, d4ei2f3, d4ei2g1, d4ei2g3, d4ei2h1, d4ei2h3, d4ei2i1, d4ei2j1, d4ei2j3, d4ei2k1, d4ei2k3, d4ei2l1, d4ei2m1, d4ei2m3, d4ei2n1, d4ei2n3, d4ei2o1, d4ei2p1
    automated match to d2aema2
    complexed with ba

Details for d4ei2h2

PDB Entry: 4ei2 (more details), 3.11 Å

PDB Description: Crystal Structures of MthK RCK gating ring bound to Barium
PDB Compounds: (H:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4ei2h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ei2h2 d.286.1.0 (H:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOPe Domain Coordinates for d4ei2h2:

Click to download the PDB-style file with coordinates for d4ei2h2.
(The format of our PDB-style files is described here.)

Timeline for d4ei2h2: