![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily) beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold |
![]() | Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) ![]() |
![]() | Family d.286.1.0: automated matches [228502] (1 protein) not a true family |
![]() | Protein automated matches [228504] (1 species) not a true protein |
![]() | Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries) |
![]() | Domain d4ei2c2: 4ei2 C:245-336 [266196] Other proteins in same PDB: d4ei2a1, d4ei2a3, d4ei2b1, d4ei2c1, d4ei2c3, d4ei2d1, d4ei2d3, d4ei2e1, d4ei2e3, d4ei2f1, d4ei2f3, d4ei2g1, d4ei2g3, d4ei2h1, d4ei2h3, d4ei2i1, d4ei2j1, d4ei2j3, d4ei2k1, d4ei2k3, d4ei2l1, d4ei2m1, d4ei2m3, d4ei2n1, d4ei2n3, d4ei2o1, d4ei2p1 automated match to d2aema2 complexed with ba |
PDB Entry: 4ei2 (more details), 3.11 Å
SCOPe Domain Sequences for d4ei2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ei2c2 d.286.1.0 (C:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii dpprdysfragdiilgigkpeeierlknyisa
Timeline for d4ei2c2:
![]() Domains from other chains: (mouse over for more information) d4ei2a1, d4ei2a2, d4ei2a3, d4ei2b1, d4ei2b2, d4ei2d1, d4ei2d2, d4ei2d3, d4ei2e1, d4ei2e2, d4ei2e3, d4ei2f1, d4ei2f2, d4ei2f3, d4ei2g1, d4ei2g2, d4ei2g3, d4ei2h1, d4ei2h2, d4ei2h3, d4ei2i1, d4ei2i2, d4ei2j1, d4ei2j2, d4ei2j3, d4ei2k1, d4ei2k2, d4ei2k3, d4ei2l1, d4ei2l2, d4ei2m1, d4ei2m2, d4ei2m3, d4ei2n1, d4ei2n2, d4ei2n3, d4ei2o1, d4ei2o2, d4ei2p1, d4ei2p2 |