Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.37: Clostridium perfringens enterotoxin (CPE), C-terminal domain [267611] (2 proteins) C-terminal part of Pfam PF03505; PubMed 17977833 describes homology between (d2quoa_), (d1w99a3), and (d1nqdb_) |
Protein automated matches [267681] (1 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [267916] (2 PDB entries) |
Domain d3zixc2: 3zix C:200-319 [265806] Other proteins in same PDB: d3zixa1, d3zixa3, d3zixb1, d3zixb3, d3zixc1, d3zixc3, d3zixd1, d3zixd3, d3zixe1, d3zixe3, d3zixf1, d3zixf3 automated match to d3am2a1 complexed with p6g |
PDB Entry: 3zix (more details), 1.9 Å
SCOPe Domain Sequences for d3zixc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zixc2 b.18.1.37 (C:200-319) automated matches {Clostridium perfringens [TaxId: 1502]} ldlaaaterlnltdalnsnpagnlydwrssnsypwtqklnlhltitatgqkyrilaskiv dfniysnnfnnlvkleqslgdgvkdhyvdisldagqyvlvmkanssysgnypysilfqkf
Timeline for d3zixc2: