Lineage for d3w2da2 (3w2d A:149-265)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179690Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2179712Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 2179713Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)
  8. 2179744Domain d3w2da2: 3w2d A:149-265 [265584]
    Other proteins in same PDB: d3w2da1, d3w2dl1, d3w2dl2
    automated match to d1se4a2
    complexed with so4

Details for d3w2da2

PDB Entry: 3w2d (more details), 3.1 Å

PDB Description: Crystal Structure of Staphylococcal Eenterotoxin B in complex with a novel neutralization monoclonal antibody Fab fragment
PDB Compounds: (A:) enterotoxin type b

SCOPe Domain Sequences for d3w2da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w2da2 d.15.6.1 (A:149-265) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

SCOPe Domain Coordinates for d3w2da2:

Click to download the PDB-style file with coordinates for d3w2da2.
(The format of our PDB-style files is described here.)

Timeline for d3w2da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3w2da1