Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries) |
Domain d3w2da2: 3w2d A:149-265 [265584] Other proteins in same PDB: d3w2da1, d3w2dl1, d3w2dl2 automated match to d1se4a2 complexed with so4 |
PDB Entry: 3w2d (more details), 3.1 Å
SCOPe Domain Sequences for d3w2da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w2da2 d.15.6.1 (A:149-265) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
Timeline for d3w2da2: