Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
Protein Staphylococcal enterotoxin B, SEB [50226] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries) |
Domain d3w2da1: 3w2d A:29-148 [265583] Other proteins in same PDB: d3w2da2, d3w2dl1, d3w2dl2 automated match to d3seba1 complexed with so4 |
PDB Entry: 3w2d (more details), 3.1 Å
SCOPe Domain Sequences for d3w2da1:
Sequence, based on SEQRES records: (download)
>d3w2da1 b.40.2.2 (A:29-148) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh
>d3w2da1 b.40.2.2 (A:29-148) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysiklgnydnv rvefknkdladkykdkyvdvfganyyyqcyfskktnrktcmyggvteh
Timeline for d3w2da1: