Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.0: automated matches [191499] (1 protein) not a true family |
Protein automated matches [190815] (21 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [267897] (3 PDB entries) |
Domain d3uzbb_: 3uzb B: [265547] automated match to d4dqna_ complexed with coi, plp |
PDB Entry: 3uzb (more details), 3 Å
SCOPe Domain Sequences for d3uzbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uzbb_ e.17.1.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 1299]} idwstlgfsyirtdlrylahwkdgewdagtltednqihlaegstalhygqqcfeglkayr cadgsinlfrpdqnaarmrmscrrllmpelsdeqfidaclqvvranehflppygtggsly lrpfvigvgdnigvrtapefifsvfcvpvgpyfkggltptnfitsdydraaphgtgaakv ggnyaasllpgyeakkrdfadviyldpathttieeagaanffaitqdgqkfvtpqspsil psitkysllwlaehrlgleveegdiridelgkfseagacgtaavitpiggiqhgddfhvf ysesepgpvtrrlydelvgiqygdkeapegwivkv
Timeline for d3uzbb_: