Lineage for d1f3td1 (1f3t D:14-43,D:284-409)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798988Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2799024Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 2799041Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 2799047Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [50628] (5 PDB entries)
    Uniprot P07805
  8. 2799055Domain d1f3td1: 1f3t D:14-43,D:284-409 [26496]
    Other proteins in same PDB: d1f3ta2, d1f3tb2, d1f3tc2, d1f3td2
    complexed with plp, put
    missing some secondary structures that made up less than one-third of the common domain

Details for d1f3td1

PDB Entry: 1f3t (more details), 2 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product.
PDB Compounds: (D:) ornithine decarboxylase

SCOPe Domain Sequences for d1f3td1:

Sequence, based on SEQRES records: (download)

>d1f3td1 b.49.2.3 (D:14-43,D:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
rflegfntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaq
sfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryyl
pemqvgewllfedmgaytvvgtssfngfqsptiyyvv

Sequence, based on observed residues (ATOM records): (download)

>d1f3td1 b.49.2.3 (D:14-43,D:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
rflegfntrdalckkisgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydh
avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg
tssfngfqsptiyyvv

SCOPe Domain Coordinates for d1f3td1:

Click to download the PDB-style file with coordinates for d1f3td1.
(The format of our PDB-style files is described here.)

Timeline for d1f3td1: