Lineage for d3fwyb_ (3fwy B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129102Species Rhodobacter sphaeroides [TaxId:272943] [267835] (2 PDB entries)
  8. 2129104Domain d3fwyb_: 3fwy B: [264802]
    automated match to d2ynmb_
    complexed with adp, mg, sf4

Details for d3fwyb_

PDB Entry: 3fwy (more details), 1.63 Å

PDB Description: crystal structure of the l protein of rhodobacter sphaeroides light- independent protochlorophyllide reductase (bchl) with mgadp bound: a homologue of the nitrogenase fe protein
PDB Compounds: (B:) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

SCOPe Domain Sequences for d3fwyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fwyb_ c.37.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
gakvfavygkggigksttssnlsaafsilgkrvlqigcdpkhdstftltgslvptvidvl
kdvdfhpeelrpedfvfegfngvmcveaggppagtgcggyvvgqtvkllkqhhllddtdv
vifdvlgdvvcggfaaplqhadqavvvtandfdsiyamnriiaavqaksknykvrlagcv
anrsratdevdrfcketnfrrlahmpdldairrsrlkkktlfemdedqdvlaaraeyirl
aeslwrgldpidphslpdrdifellgfd

SCOPe Domain Coordinates for d3fwyb_:

Click to download the PDB-style file with coordinates for d3fwyb_.
(The format of our PDB-style files is described here.)

Timeline for d3fwyb_: