Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:272943] [267835] (2 PDB entries) |
Domain d3fwyb_: 3fwy B: [264802] automated match to d2ynmb_ complexed with adp, mg, sf4 |
PDB Entry: 3fwy (more details), 1.63 Å
SCOPe Domain Sequences for d3fwyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fwyb_ c.37.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} gakvfavygkggigksttssnlsaafsilgkrvlqigcdpkhdstftltgslvptvidvl kdvdfhpeelrpedfvfegfngvmcveaggppagtgcggyvvgqtvkllkqhhllddtdv vifdvlgdvvcggfaaplqhadqavvvtandfdsiyamnriiaavqaksknykvrlagcv anrsratdevdrfcketnfrrlahmpdldairrsrlkkktlfemdedqdvlaaraeyirl aeslwrgldpidphslpdrdifellgfd
Timeline for d3fwyb_: