SCOPe 2.08: Domain d3fwyb_: 3fwy B:

Lineage for d3fwyb_ (3fwy B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [267835] (3 PDB entries)

8. Domain d3fwyb_: 3fwy B: [264802]
   automated match to d2ynmb_
   complexed with adp, mg, sf4

Details for d3fwyb_

PDB Entry: 3fwy, 1.63 Å

PDB Description: crystal structure of the l protein of rhodobacter sphaeroides light- independent protochlorophyllide reductase (bchl) with mgadp bound: a homologue of the nitrogenase fe protein

PDB Compounds: (B:) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

SCOPe Domain Sequences for d3fwyb_:

Sequence; same for both SEQRES and ATOM records:

>d3fwyb_ c.37.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
gakvfavygkggigksttssnlsaafsilgkrvlqigcdpkhdstftltgslvptvidvl
kdvdfhpeelrpedfvfegfngvmcveaggppagtgcggyvvgqtvkllkqhhllddtdv
vifdvlgdvvcggfaaplqhadqavvvtandfdsiyamnriiaavqaksknykvrlagcv
anrsratdevdrfcketnfrrlahmpdldairrsrlkkktlfemdedqdvlaaraeyirl
aeslwrgldpidphslpdrdifellgfd

Timeline for d3fwyb_:

• d3fwyb_ first appeared in SCOPe 2.05
  
• d3fwyb_ appears in SCOPe 2.07