Lineage for d2qjjb1 (2qjj B:1-111)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905637Species Novosphingobium aromaticivorans [TaxId:48935] [267801] (3 PDB entries)
  8. 1905639Domain d2qjjb1: 2qjj B:1-111 [264462]
    Other proteins in same PDB: d2qjja2, d2qjjb2, d2qjjc2, d2qjjd2
    automated match to d4il2a1
    complexed with mg

Details for d2qjjb1

PDB Entry: 2qjj (more details), 1.8 Å

PDB Description: Crystal structure of D-Mannonate dehydratase from Novosphingobium aromaticivorans
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2qjjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjjb1 d.54.1.0 (B:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg

SCOPe Domain Coordinates for d2qjjb1:

Click to download the PDB-style file with coordinates for d2qjjb1.
(The format of our PDB-style files is described here.)

Timeline for d2qjjb1: