PDB entry 2qjj

View 2qjj on RCSB PDB site
Description: Crystal structure of D-Mannonate dehydratase from Novosphingobium aromaticivorans
Class: lyase
Keywords: Mannonate dehydratase, Enolase superfamily, LYASE
Deposited on 2007-07-07, released 2007-10-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qjja1, d2qjja2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qjjb1, d2qjjb2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qjjc1, d2qjjc2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qjjd1, d2qjjd2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qjjA (A:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepadaslpsvtg
    wdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctp
    aenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriad
    laslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekg
    elfvgetpghgvdideelaakypykpaylpvarledgtmwnw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qjjB (B:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepadaslpsvtg
    wdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctp
    aenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriad
    laslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekg
    elfvgetpghgvdideelaakypykpaylpvarledgtmwnw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qjjC (C:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepadaslpsvtg
    wdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctp
    aenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriad
    laslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekg
    elfvgetpghgvdideelaakypykpaylpvarledgtmwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjjC (C:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgislpsvtgwdtrkalnyvpklfeelr
    ktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafrlvrqhtvtpl
    avgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvrtgchgatdls
    pvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetpghgvdideel
    aakypykpaylpvarledgtmwnw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qjjD (D:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepadaslpsvtg
    wdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctp
    aenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriad
    laslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekg
    elfvgetpghgvdideelaakypykpaylpvarledgtmwnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qjjD (D:)
    mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
    rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllggrsrdgimvy
    ghangsdiaetveavghyidmgykairaqtgvpgikdaslpsvtgwdtrkalnyvpklfe
    elrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafrlvrqhtv
    tplavgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvrtgchgat
    dlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetpghgvdid
    eelaakypykpaylpvarledgtmwnw