![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein NS3 protease [50600] (2 species) |
![]() | Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries) |
![]() | Domain d1cu1a1: 1cu1 A:705-720,A:3-186 [26408] Other proteins in same PDB: d1cu1a2, d1cu1a3, d1cu1b2, d1cu1b3 |
PDB Entry: 1cu1 (more details), 2.5 Å
SCOP Domain Sequences for d1cu1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cu1a1 b.47.1.3 (A:705-720,A:3-186) NS3 protease {Human hepatitis C virus (HCV), different isolates} gsvvivgriilsgsgsXitaysqqtrgllgciitsltgrdknqvegevqvvstatqsfla tcvngvcwtvyhgagsktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdly lvtrhadvipvrrrgdsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvak avdfvpvesmettmrspvftd
Timeline for d1cu1a1: