![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.14: RNA helicase [52724] (1 protein) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
![]() | Protein HCV helicase domain [52725] (1 species) |
![]() | Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (6 PDB entries) |
![]() | Domain d1cu1b2: 1cu1 B:1187-1325 [32473] Other proteins in same PDB: d1cu1a1, d1cu1b1 |
PDB Entry: 1cu1 (more details), 2.5 Å
SCOP Domain Sequences for d1cu1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cu1b2 c.37.1.14 (B:1187-1325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates} nssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah gidpnirtgvrtittgapvtystygkfladggcsggaydiiicdechstdsttilgigtv ldqaetagarlvvlatatp
Timeline for d1cu1b2: