Lineage for d4reub_ (4reu B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990252Protein Non-hem ferritin [63524] (7 species)
  7. 1990257Species Escherichia coli [TaxId:1110693] [260578] (1 PDB entry)
  8. 1990259Domain d4reub_: 4reu B: [263857]
    automated match to d4reua_
    complexed with cl, fe, hg, mes, mg, so4

Details for d4reub_

PDB Entry: 4reu (more details), 2.5 Å

PDB Description: revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d4reub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4reub_ a.25.1.1 (B:) Non-hem ferritin {Escherichia coli [TaxId: 1110693]}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn

SCOPe Domain Coordinates for d4reub_:

Click to download the PDB-style file with coordinates for d4reub_.
(The format of our PDB-style files is described here.)

Timeline for d4reub_: