SCOPe 2.06: Domain d4reuc_: 4reu C:

Lineage for d4reuc_ (4reu C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Non-hem ferritin [63524] (7 species)

7. Species Escherichia coli [TaxId:1110693] [260578] (1 PDB entry)

8. Domain d4reuc_: 4reu C: [263858]
   automated match to d4reua_
   complexed with cl, fe, hg, mes, mg, so4

Details for d4reuc_

PDB Entry: 4reu, 2.5 Å

PDB Description: revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli

PDB Compounds: (C:) Ferritin

SCOPe Domain Sequences for d4reuc_:

Sequence; same for both SEQRES and ATOM records:

>d4reuc_ a.25.1.1 (C:) Non-hem ferritin {Escherichia coli [TaxId: 1110693]}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn

Timeline for d4reuc_:

• d4reuc_ first appeared in SCOPe 2.05
  
• d4reuc_ appears in SCOPe 2.07
  
• d4reuc_ appears in the current release, SCOPe 2.08