Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d4pjea1: 4pje A:1-178 [263520] Other proteins in same PDB: d4pjea2, d4pjeb1, d4pjeb2, d4pjec2, d4pjed1, d4pjed2, d4pjee1, d4pjee2, d4pjef1, d4pjef2, d4pjeg1, d4pjeg2, d4pjeh1, d4pjeh2 automated match to d4l4vc1 complexed with 30w, act, cl, gol, na |
PDB Entry: 4pje (more details), 1.95 Å
SCOPe Domain Sequences for d4pjea1:
Sequence, based on SEQRES records: (download)
>d4pjea1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
>d4pjea1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwery tqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdflif nkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4pjea1: