SCOPe 2.06: Domain d4pjec1: 4pje C:1-178

Lineage for d4pjec1 (4pje C:1-178)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d4pjec1: 4pje C:1-178 [263522]
   Other proteins in same PDB: d4pjea2, d4pjeb1, d4pjeb2, d4pjec2, d4pjed1, d4pjed2, d4pjee1, d4pjee2, d4pjef1, d4pjef2, d4pjeg1, d4pjeg2, d4pjeh1, d4pjeh2
   automated match to d4l4vc1
   complexed with 30w, act, cl, gol, na

Details for d4pjec1

PDB Entry: 4pje, 1.95 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-b10 tcr

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjec1:

Sequence; same for both SEQRES and ATOM records:

>d4pjec1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d4pjec1:

• d4pjec1 first appeared in SCOPe 2.05
  
• d4pjec1 appears in SCOPe 2.07
  
• d4pjec1 appears in the current release, SCOPe 2.08