Lineage for d4omce2 (4omc E:443-574)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2047120Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2047121Protein automated matches [190770] (37 species)
    not a true protein
  7. 2047326Species Human (Homo sapiens) [TaxId:9606] [188939] (20 PDB entries)
  8. 2047360Domain d4omce2: 4omc E:443-574 [263318]
    Other proteins in same PDB: d4omca1, d4omcb1, d4omcc1, d4omcd1, d4omce1, d4omcf1
    automated match to d1p8ja1
    complexed with ca, fmt, na

Details for d4omce2

PDB Entry: 4omc (more details), 2.3 Å

PDB Description: X-ray structure of human furin in complex with the competitive inhibitor meta-guanidinomethyl-Phac-RVR-Amba
PDB Compounds: (E:) Furin

SCOPe Domain Sequences for d4omce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omce2 b.18.1.0 (E:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla
ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt
ltkftlvlygta

SCOPe Domain Coordinates for d4omce2:

Click to download the PDB-style file with coordinates for d4omce2.
(The format of our PDB-style files is described here.)

Timeline for d4omce2: