SCOPe 2.06: Domain d4omcd2: 4omc D:443-574

Lineage for d4omcd2 (4omc D:443-574)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188939] (20 PDB entries)

8. Domain d4omcd2: 4omc D:443-574 [238476]
   Other proteins in same PDB: d4omca1, d4omcb1, d4omcc1, d4omcd1, d4omce1, d4omcf1
   automated match to d1p8ja1
   complexed with ca, fmt, na

Details for d4omcd2

PDB Entry: 4omc, 2.3 Å

PDB Description: X-ray structure of human furin in complex with the competitive inhibitor meta-guanidinomethyl-Phac-RVR-Amba

PDB Compounds: (D:) Furin

SCOPe Domain Sequences for d4omcd2:

Sequence; same for both SEQRES and ATOM records:

>d4omcd2 b.18.1.0 (D:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla
ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt
ltkftlvlygta

Timeline for d4omcd2:

• d4omcd2 first appeared in SCOPe 2.03
  
• d4omcd2 appears in SCOPe 2.05
  
• d4omcd2 appears in SCOPe 2.07
  
• d4omcd2 appears in the current release, SCOPe 2.08