Lineage for d4nefb_ (4nef B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024308Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 3024309Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 3024360Family f.19.1.0: automated matches [191436] (1 protein)
    not a true family
  6. 3024361Protein automated matches [190629] (7 species)
    not a true protein
  7. 3024371Species Human (Homo sapiens) [TaxId:9606] [225512] (6 PDB entries)
  8. 3024382Domain d4nefb_: 4nef B: [263129]
    Other proteins in same PDB: d4nefa2, d4nefd2
    automated match to d3d9sa_
    complexed with cd, zn

Details for d4nefb_

PDB Entry: 4nef (more details), 2.75 Å

PDB Description: X-ray structure of human Aquaporin 2
PDB Compounds: (B:) Aquaporin-2

SCOPe Domain Sequences for d4nefb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nefb_ f.19.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siafsravfaeflatllfvffglgsalnwpqalpsvlqiamafglgigtlvqalghisga
hinpavtvaclvgchvsvlraafyvaaqllgavagaallheitpadirgdlavnalsnst
tagqavtvelfltlqlvlcifastderrgenpgtpalsigfsvalghllgihytgcsmnp
arslapavvtgkfddhwvfwigplvgailgsllynyvlfppakslserlavlk

SCOPe Domain Coordinates for d4nefb_:

Click to download the PDB-style file with coordinates for d4nefb_.
(The format of our PDB-style files is described here.)

Timeline for d4nefb_: