Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (2 families) |
Family f.19.1.0: automated matches [191436] (1 protein) not a true family |
Protein automated matches [190629] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225512] (6 PDB entries) |
Domain d4nefb_: 4nef B: [263129] Other proteins in same PDB: d4nefa2, d4nefd2 automated match to d3d9sa_ complexed with cd, zn |
PDB Entry: 4nef (more details), 2.75 Å
SCOPe Domain Sequences for d4nefb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nefb_ f.19.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} siafsravfaeflatllfvffglgsalnwpqalpsvlqiamafglgigtlvqalghisga hinpavtvaclvgchvsvlraafyvaaqllgavagaallheitpadirgdlavnalsnst tagqavtvelfltlqlvlcifastderrgenpgtpalsigfsvalghllgihytgcsmnp arslapavvtgkfddhwvfwigplvgailgsllynyvlfppakslserlavlk
Timeline for d4nefb_: