SCOPe 2.08: Domain d4mjsu1: 4mjs U:15-100

Lineage for d4mjsu1 (4mjs U:15-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (11 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein automated matches [190335] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [259200] (1 PDB entry)

8. Domain d4mjsu1: 4mjs U:15-100 [263030]
   Other proteins in same PDB: d4mjsa2, d4mjsc2, d4mjse2, d4mjsg2, d4mjsi2, d4mjsk2, d4mjsm2, d4mjso2, d4mjsq2, d4mjss2, d4mjsu2, d4mjsw2
   automated match to d4mjsc_
   complexed with edo

Details for d4mjsu1

PDB Entry: 4mjs, 2.5 Å

PDB Description: crystal structure of a PB1 complex

PDB Compounds: (U:) Protein kinase C zeta type

SCOPe Domain Sequences for d4mjsu1:

Sequence, based on SEQRES records:

>d4mjsu1 d.15.2.2 (U:15-100) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctvssqm
eleeafrlacqgrdevliihvfpsip

Sequence, based on observed residues (ATOM records):

>d4mjsu1 d.15.2.2 (U:15-100) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvssqme
leeafrlacqgrdevliihvfpsip

Timeline for d4mjsu1:

• d4mjsu1 first appeared in SCOPe 2.05, called d4mjsu_
  
• d4mjsu1 appears in SCOPe 2.07