Lineage for d4m0xb2 (4m0x B:130-370)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837720Species Rhodococcus opacus [TaxId:37919] [257921] (1 PDB entry)
  8. 2837722Domain d4m0xb2: 4m0x B:130-370 [262996]
    Other proteins in same PDB: d4m0xa1, d4m0xb1
    automated match to d4m0xa2
    complexed with cl, mn

Details for d4m0xb2

PDB Entry: 4m0x (more details), 2.7 Å

PDB Description: Crystal structure of 2-chloromuconate cycloisomerase from Rhodococcus opacus 1CP
PDB Compounds: (B:) chloromuconate cycloisomerase

SCOPe Domain Sequences for d4m0xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m0xb2 c.1.11.0 (B:130-370) automated matches {Rhodococcus opacus [TaxId: 37919]}
lrrkripitwafsagsasdlideaaqkldvghrsfkfkmgaepadtdsrrvldvlecipd
ecavivdpngrwseleahrwlpiladagvtvaeqpiarwntdglarlrdklsipimades
vttvqqaialadagavsafaikipksgglsrareiaaiaeasglacfgaatpessvmgai
saqlygtmpdlsvgcelfgpgllidevvteplkydrgelliptgpgsgvnldeerlrkys
r

SCOPe Domain Coordinates for d4m0xb2:

Click to download the PDB-style file with coordinates for d4m0xb2.
(The format of our PDB-style files is described here.)

Timeline for d4m0xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m0xb1