PDB entry 4m0x

View 4m0x on RCSB PDB site
Description: Crystal structure of 2-chloromuconate cycloisomerase from Rhodococcus opacus 1CP
Class: isomerase
Keywords: isomerase, chloromuconate
Deposited on 2013-08-02, released 2014-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.181
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloromuconate cycloisomerase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L1 (Start-370)
      • conflict (112-114)
    Domains in SCOPe 2.07: d4m0xa1, d4m0xa2
  • Chain 'B':
    Compound: chloromuconate cycloisomerase
    Species: RHODOCOCCUS OPACUS [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9L1 (0-End)
      • conflict (112-114)
    Domains in SCOPe 2.07: d4m0xb1, d4m0xb2
  • Heterogens: MN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m0xA (A:)
    mtttitemsativdlpsrrphkfaattmhhqsivlvrvrdsdggegigeavtpggpwwgg
    esvetiktiidqylapviigrdpstigvasqsmdglvfgnsvakaaietalwddrerrsr
    ipvsdllgglrrkripitwafsagsasdlideaaqkldvghrsfkfkmgaepadtdsrrv
    ldvlecipdecavivdpngrwseleahrwlpiladagvtvaeqpiarwntdglarlrdkl
    sipimadesvttvqqaialadagavsafaikipksgglsrareiaaiaeasglacfgaat
    pessvmgaisaqlygtmpdlsvgcelfgpgllidevvteplkydrgelliptgpgsgvnl
    deerlrkysrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0xA (A:)
    ttitemsativdlpsrrphkfaattmhhqsivlvrvrdsdggegigeavtpggpwwgges
    vetiktiidqylapviigrdpstigvasqsmdglvfgnsvakaaietalwddrerrsrip
    vsdllgglrrkripitwafsagsasdlideaaqkldvghrsfkfkmgaepadtdsrrvld
    vlecipdecavivdpngrwseleahrwlpiladagvtvaeqpiarwntdglarlrdklsi
    pimadesvttvqqaialadagavsafaikipksgglsrareiaaiaeasglacfgaatpe
    ssvmgaisaqlygtmpdlsvgcelfgpgllidevvteplkydrgelliptgpgsgvnlde
    erlrkysrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m0xB (B:)
    mtttitemsativdlpsrrphkfaattmhhqsivlvrvrdsdggegigeavtpggpwwgg
    esvetiktiidqylapviigrdpstigvasqsmdglvfgnsvakaaietalwddrerrsr
    ipvsdllgglrrkripitwafsagsasdlideaaqkldvghrsfkfkmgaepadtdsrrv
    ldvlecipdecavivdpngrwseleahrwlpiladagvtvaeqpiarwntdglarlrdkl
    sipimadesvttvqqaialadagavsafaikipksgglsrareiaaiaeasglacfgaat
    pessvmgaisaqlygtmpdlsvgcelfgpgllidevvteplkydrgelliptgpgsgvnl
    deerlrkysrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m0xB (B:)
    mtttitemsativdlpsrrhhqsivlvrvrdsdggegigeavtpggpwwggesvetikti
    idqylapviigrdpstigvasqsmdglvfgnsvakaaietalwddrerrsripvsdllgg
    lrrkripitwafsagsasdlideaaqkldvghrsfkfkmgaepadtdsrrvldvlecipd
    ecavivdpngrwseleahrwlpiladagvtvaeqpiarwntdglarlrdklsipimades
    vttvqqaialadagavsafaikipksgglsrareiaaiaeasglacfgaatpessvmgai
    saqlygtmpdlsvgcelfgpgllidevvteplkydrgelliptgpgsgvnldeerlrkys
    r