Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Coagulation factor VIIa [50550] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50551] (33 PDB entries) |
Domain d1danh_: 1dan H: [26292] Other proteins in same PDB: d1dan.1, d1danl1, d1danl2, d1danl3, d1danu1 complexed with ca, cac, ch2, cl, fuc, glc |
PDB Entry: 1dan (more details), 2 Å
SCOP Domain Sequences for d1danh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1danh_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d1danh_: