| Class g: Small proteins [56992] (85 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (22 proteins) |
| Protein Coagulation factor VIIa [57201] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries) |
| Domain d1danl1: 1dan L:49-86 [44209] Other proteins in same PDB: d1dan.1, d1danh_, d1danl3, d1danu1 |
PDB Entry: 1dan (more details), 2 Å
SCOP Domain Sequences for d1danl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1danl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d1danl1:
View in 3DDomains from other chains: (mouse over for more information) d1dan.1, d1dan.1, d1danh_, d1danu1 |