SCOP 1.73: Domain d1danu1: 1dan U:107-210

Lineage for d1danu1 (1dan U:107-210)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)

8. Domain d1danu1: 1dan U:107-210 [21954]
   Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3
   complexed with ca, cac, ch2, cl, fuc, glc

Details for d1danu1

PDB Entry: 1dan, 2 Å

PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor

PDB Compounds: (U:) soluble tissue factor

SCOP Domain Sequences for d1danu1:

Sequence, based on SEQRES records:

>d1danu1 b.1.2.1 (U:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Sequence, based on observed residues (ATOM records):

>d1danu1 b.1.2.1 (U:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywsgkktakt
ntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Timeline for d1danu1:

• d1danu1 first appeared (with stable ids) in SCOP 1.55
  
• d1danu1 appears in SCOP 1.71
  
• d1danu1 appears in SCOP 1.75
  
• d1danu1 appears in the current release, SCOPe 2.08