Lineage for d4cbxg_ (4cbx G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969841Protein automated matches [226883] (2 species)
    not a true protein
  7. 2969848Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries)
  8. 2969862Domain d4cbxg_: 4cbx G: [262565]
    Other proteins in same PDB: d4cbxa1, d4cbxa2
    automated match to d3cipg_
    complexed with atp, ca, na, po4, so4

Details for d4cbxg_

PDB Entry: 4cbx (more details), 2.2 Å

PDB Description: crystal structure of plasmodium berghei actin ii
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d4cbxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cbxg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggvas
gf

SCOPe Domain Coordinates for d4cbxg_:

Click to download the PDB-style file with coordinates for d4cbxg_.
(The format of our PDB-style files is described here.)

Timeline for d4cbxg_: