Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Plasmodium berghei [TaxId:5821] [256595] (1 PDB entry) |
Domain d4cbxa2: 4cbx A:147-373 [256597] Other proteins in same PDB: d4cbxg_ automated match to d1c0fa2 complexed with atp, ca, na, po4, so4 |
PDB Entry: 4cbx (more details), 2.2 Å
SCOPe Domain Sequences for d4cbxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cbxa2 c.55.1.0 (A:147-373) automated matches {Plasmodium berghei [TaxId: 5821]} rttgivldsgdgvthtvpiyegyvlphainrtdmagrdltyymmklftergytftttaer eivrdikeklcyialdydeelkkseerteeveemyelpdgnlitvgserfrcpealfnps ligrecpglhitayqsimkcdidirkelynnivlsggttmynyigerltnemtslappsm kikviapperkysvwiggsilsslstfqkmwitkeeydesgpsivhr
Timeline for d4cbxa2: