SCOPe 2.08: Domain d4cbxa2: 4cbx A:147-373

Lineage for d4cbxa2 (4cbx A:147-373)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Plasmodium berghei [TaxId:5821] [256595] (1 PDB entry)

8. Domain d4cbxa2: 4cbx A:147-373 [256597]
   Other proteins in same PDB: d4cbxg_
   automated match to d1c0fa2
   complexed with atp, ca, na, po4, so4

Details for d4cbxa2

PDB Entry: 4cbx, 2.2 Å

PDB Description: crystal structure of plasmodium berghei actin ii

PDB Compounds: (A:) actin-2

SCOPe Domain Sequences for d4cbxa2:

Sequence; same for both SEQRES and ATOM records:

>d4cbxa2 c.55.1.0 (A:147-373) automated matches {Plasmodium berghei [TaxId: 5821]}
rttgivldsgdgvthtvpiyegyvlphainrtdmagrdltyymmklftergytftttaer
eivrdikeklcyialdydeelkkseerteeveemyelpdgnlitvgserfrcpealfnps
ligrecpglhitayqsimkcdidirkelynnivlsggttmynyigerltnemtslappsm
kikviapperkysvwiggsilsslstfqkmwitkeeydesgpsivhr

Timeline for d4cbxa2:

• d4cbxa2 first appeared in SCOPe 2.04
  
• d4cbxa2 appears in SCOPe 2.07