Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Aeropyrum pernix [TaxId:56636] [255746] (2 PDB entries) |
Domain d3wxmc1: 3wxm C:4-227 [262481] Other proteins in same PDB: d3wxma2, d3wxma3, d3wxmc2, d3wxmc3, d3wxme2, d3wxme3, d3wxmg2, d3wxmg3 protein/RNA complex; complexed with gtp, mg |
PDB Entry: 3wxm (more details), 2.3 Å
SCOPe Domain Sequences for d3wxmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxmc1 c.37.1.0 (C:4-227) automated matches {Aeropyrum pernix [TaxId: 56636]} kphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkmk eerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgefe agmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgyq vdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppak
Timeline for d3wxmc1: