Lineage for d3wxmg1 (3wxm G:3-227)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128230Species Aeropyrum pernix [TaxId:56636] [255746] (2 PDB entries)
  8. 2128233Domain d3wxmg1: 3wxm G:3-227 [262487]
    Other proteins in same PDB: d3wxma2, d3wxma3, d3wxmc2, d3wxmc3, d3wxme2, d3wxme3, d3wxmg2, d3wxmg3
    protein/RNA complex; complexed with gtp, mg

Details for d3wxmg1

PDB Entry: 3wxm (more details), 2.3 Å

PDB Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
PDB Compounds: (G:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3wxmg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxmg1 c.37.1.0 (G:3-227) automated matches {Aeropyrum pernix [TaxId: 56636]}
ekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkm
keerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgef
eagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgy
qvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppak

SCOPe Domain Coordinates for d3wxmg1:

Click to download the PDB-style file with coordinates for d3wxmg1.
(The format of our PDB-style files is described here.)

Timeline for d3wxmg1: