Lineage for d4whtn2 (4wht N:112-215)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1764300Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (2 PDB entries)
  8. 1764304Domain d4whtn2: 4wht N:112-215 [262090]
    Other proteins in same PDB: d4whtb1, d4whtd1, d4whtf1, d4whth1, d4whtj1, d4whtl1, d4whtn1, d4whtp1, d4whtr1, d4whtt1, d4whtv1, d4whty1
    automated match to d1c5da2

Details for d4whtn2

PDB Entry: 4wht (more details), 2.22 Å

PDB Description: Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, P1 crystal form
PDB Compounds: (N:) Light chain of the Fab fragment derived from neutralizing antibody 3/11

SCOPe Domain Sequences for d4whtn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4whtn2 b.1.1.2 (N:112-215) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnr

SCOPe Domain Coordinates for d4whtn2:

Click to download the PDB-style file with coordinates for d4whtn2.
(The format of our PDB-style files is described here.)

Timeline for d4whtn2: