Lineage for d4whth1 (4wht H:0-111)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767431Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (5 PDB entries)
  8. 1767441Domain d4whth1: 4wht H:0-111 [262073]
    Other proteins in same PDB: d4whtb2, d4whtd2, d4whtl2, d4whtn2, d4whtp2, d4whtr2, d4whtt2, d4whtv2, d4whty2
    automated match to d1c5da1

Details for d4whth1

PDB Entry: 4wht (more details), 2.22 Å

PDB Description: Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, P1 crystal form
PDB Compounds: (H:) Light chain of the Fab fragment derived from neutralizing antibody 3/11

SCOPe Domain Sequences for d4whth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4whth1 b.1.1.0 (H:0-111) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnl
esgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelk

SCOPe Domain Coordinates for d4whth1:

Click to download the PDB-style file with coordinates for d4whth1.
(The format of our PDB-style files is described here.)

Timeline for d4whth1: