Lineage for d4nd4a2 (4nd4 A:165-333)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232567Species Cryptosporidium parvum [TaxId:5807] [225186] (10 PDB entries)
  8. 2232588Domain d4nd4a2: 4nd4 A:165-333 [261820]
    Other proteins in same PDB: d4nd4a1, d4nd4b1
    automated match to d2ewda2
    complexed with gol, nad, pyr

Details for d4nd4a2

PDB Entry: 4nd4 (more details), 2.2 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (pyruvic acid) and cofactor (b- nicotinamide adenine dinucleotide)
PDB Compounds: (A:) Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase

SCOPe Domain Sequences for d4nd4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nd4a2 d.162.1.1 (A:165-333) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq
eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg
vkgiymgvptiigkngvedileldltpleqkllgesinevntiskvldnap

SCOPe Domain Coordinates for d4nd4a2:

Click to download the PDB-style file with coordinates for d4nd4a2.
(The format of our PDB-style files is described here.)

Timeline for d4nd4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nd4a1