SCOPe 2.06: Domain d4cpqa_: 4cpq A:

Lineage for d4cpqa_ (4cpq A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus [TaxId:12721] [188065] (13 PDB entries)

8. Domain d4cpqa_: 4cpq A: [261765]
   automated match to d2xyfa_
   complexed with 9mw, cl

Details for d4cpqa_

PDB Entry: 4cpq, 2.35 Å

PDB Description: macrocyclic transition-state mimicking hiv-1 protease inhibitors encompassing a tertiary alcohol

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d4cpqa_:

Sequence; same for both SEQRES and ATOM records:

>d4cpqa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d4cpqa_:

• d4cpqa_ first appeared in SCOPe 2.04
  
• d4cpqa_ appears in SCOPe 2.05
  
• d4cpqa_ appears in SCOPe 2.07
  
• d4cpqa_ appears in the current release, SCOPe 2.08