SCOPe 2.06: Domain d4or7a1: 4or7 A:1-159

Lineage for d4or7a1 (4or7 A:1-159)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (11 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:1244085] [261371] (2 PDB entries)

8. Domain d4or7a1: 4or7 A:1-159 [261372]
   Other proteins in same PDB: d4or7a2
   automated match to d3k74a_
   complexed with 25u, nap

Details for d4or7a1

PDB Entry: 4or7, 1.76 Å

PDB Description: Klebsiella pneumoniae dihydrofolate reductase complexed with NADPH and 6-ethyl-5-{3-[3-(pyrimidin-5-yl)phenyl]prop-1-yn-1-yl}pyrimidine-2,4-diamine

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4or7a1:

Sequence; same for both SEQRES and ATOM records:

>d4or7a1 c.71.1.1 (A:1-159) automated matches {Klebsiella pneumoniae [TaxId: 1244085]}
misliaalavdrvigmenampwnlpadlawfkrntlnkpvvmgrltwesigrplpgrkni
visskpgsddrvqwvssveeaiaacgdveeimvigggrvyeqflpkaqklylthidaeve
gdthfpdydpdewesvfsefhdadaqnshsycfeilerr

Timeline for d4or7a1:

• d4or7a1 first appeared in SCOPe 2.04, called d4or7a_
  
• d4or7a1 was called d4or7a_ in SCOPe 2.05
  
• d4or7a1 appears in SCOPe 2.07
  
• d4or7a1 appears in the current release, SCOPe 2.08