SCOPe 2.05: Domain d4kxzm2: 4kxz M:108-213

Lineage for d4kxzm2 (4kxz M:108-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4kxzm2: 4kxz M:108-213 [261344]
   Other proteins in same PDB: d4kxza_, d4kxzb_, d4kxzd_, d4kxze_, d4kxzi1, d4kxzl1, d4kxzm1, d4kxzp1
   automated match to d1dn0a2
   complexed with mes, pe5

Details for d4kxzm2

PDB Entry: 4kxz, 2.83 Å

PDB Description: crystal structure of tgfb2 in complex with GC2008.

PDB Compounds: (M:) GC1008 Light Chain

SCOPe Domain Sequences for d4kxzm2:

Sequence; same for both SEQRES and ATOM records:

>d4kxzm2 b.1.1.2 (M:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4kxzm2:

• d4kxzm2 first appeared in SCOPe 2.04
  
• d4kxzm2 appears in SCOPe 2.06
  
• d4kxzm2 appears in the current release, SCOPe 2.08