SCOPe 2.05: Domain d4kxzl1: 4kxz L:1-107

Lineage for d4kxzl1 (4kxz L:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d4kxzl1: 4kxz L:1-107 [259787]
   Other proteins in same PDB: d4kxza_, d4kxzb_, d4kxzd_, d4kxze_, d4kxzi2, d4kxzl2, d4kxzm2, d4kxzp2
   automated match to d1dn0a1
   complexed with mes, pe5

Details for d4kxzl1

PDB Entry: 4kxz, 2.83 Å

PDB Description: crystal structure of tgfb2 in complex with GC2008.

PDB Compounds: (L:) GC1008 Light Chain

SCOPe Domain Sequences for d4kxzl1:

Sequence; same for both SEQRES and ATOM records:

>d4kxzl1 b.1.1.1 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrlei

Timeline for d4kxzl1:

• d4kxzl1 first appeared in SCOPe 2.04
  
• d4kxzl1 appears in SCOPe 2.06
  
• d4kxzl1 appears in the current release, SCOPe 2.08