Lineage for d4q2nf_ (4q2n F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1786401Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 1786402Protein automated matches [190436] (6 species)
    not a true protein
  7. 1786416Species Human (Homo sapiens) [TaxId:9606] [187333] (84 PDB entries)
  8. 1786519Domain d4q2nf_: 4q2n F: [261252]
    automated match to d3cbxa_
    complexed with edo

Details for d4q2nf_

PDB Entry: 4q2n (more details), 2 Å

PDB Description: inadl pdz3 in complex with a phage-derived peptide
PDB Compounds: (F:) InaD-like protein

SCOPe Domain Sequences for d4q2nf_:

Sequence, based on SEQRES records: (download)

>d4q2nf_ b.36.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmetynvelvrkdgqslgirivgyvgtshtgeasgiyvksiipgsaayhnghiqvndki
vavdgvniqgfanhdvvevlrnagqvvhltlvrrgggwfldi

Sequence, based on observed residues (ATOM records): (download)

>d4q2nf_ b.36.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmetynvelvrkdgqslgirivgyvgtsasgiyvksiipgsaayhnghiqvndkivavd
gvniqgfanhdvvevlrnagqvvhltlvrrgggwfldi

SCOPe Domain Coordinates for d4q2nf_:

Click to download the PDB-style file with coordinates for d4q2nf_.
(The format of our PDB-style files is described here.)

Timeline for d4q2nf_: