Lineage for d4pkwa2 (4pkw A:551-776)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964794Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
    automatically mapped to Pfam PF07737
  6. 2964828Protein automated matches [234341] (1 species)
    not a true protein
  7. 2964829Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234342] (14 PDB entries)
  8. 2964831Domain d4pkwa2: 4pkw A:551-776 [261245]
    Other proteins in same PDB: d4pkwa1
    automated match to d1j7na2
    complexed with edo, gm6, gol, zn

Details for d4pkwa2

PDB Entry: 4pkw (more details), 1.75 Å

PDB Description: anthrax toxin lethal factor with bound small molecule inhibitor gm6001
PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d4pkwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pkwa2 d.92.1.14 (A:551-776) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

SCOPe Domain Coordinates for d4pkwa2:

Click to download the PDB-style file with coordinates for d4pkwa2.
(The format of our PDB-style files is described here.)

Timeline for d4pkwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pkwa1