Lineage for d4pkva2 (4pkv A:551-776)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964794Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
    automatically mapped to Pfam PF07737
  6. 2964828Protein automated matches [234341] (1 species)
    not a true protein
  7. 2964829Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234342] (14 PDB entries)
  8. 2964839Domain d4pkva2: 4pkv A:551-776 [260941]
    Other proteins in same PDB: d4pkva1, d4pkva3, d4pkva4
    automated match to d1j7na2
    complexed with 30r, zn

Details for d4pkva2

PDB Entry: 4pkv (more details), 2.5 Å

PDB Description: anthrax toxin lethal factor with bound small molecule inhibitor 16
PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d4pkva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pkva2 d.92.1.14 (A:551-776) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

SCOPe Domain Coordinates for d4pkva2:

Click to download the PDB-style file with coordinates for d4pkva2.
(The format of our PDB-style files is described here.)

Timeline for d4pkva2: