SCOPe 2.05: Domain d4ceuc2: 4ceu C:132-434,C:484-570

Lineage for d4ceuc2 (4ceu C:132-434,C:484-570)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)

6. Protein alpha-subunit of urease, catalytic domain [51561] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [51563] (9 PDB entries)

8. Domain d4ceuc2: 4ceu C:132-434,C:484-570 [259179]
   Other proteins in same PDB: d4ceua_, d4ceub_, d4ceuc1
   automated match to d4ubpc2
   complexed with edo, ni, oh, so4

Details for d4ceuc2

PDB Entry: 4ceu, 1.58 Å

PDB Description: 1.58 a resolution native sporosarcina pasteurii urease

PDB Compounds: (C:) urease subunit alpha

SCOPe Domain Sequences for d4ceuc2:

Sequence; same for both SEQRES and ATOM records:

>d4ceuc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf

Timeline for d4ceuc2:

• d4ceuc2 first appeared in SCOPe 2.04
  
• d4ceuc2 appears in SCOPe 2.06
  
• d4ceuc2 appears in the current release, SCOPe 2.08