Lineage for d4ubpc2 (4ubp C:132-434,C:484-570)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein) Protein alpha-subunit of urease, catalytic domain [51561] (4 species) Species Bacillus pasteurii [TaxId:1474] [51563] (9 PDB entries) 
Domain d4ubpc2: 4ubp C:132-434,C:484-570 [29053]
Other proteins in same PDB: d4ubpa_, d4ubpb_, d4ubpc1
complexed with hae, ni
Details for d4ubpc2
PDB Entry: 4ubp (more details), 1.55 Å
PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution
PDB Compounds: (C:) protein (urease (chain c))SCOPe Domain Sequences for d4ubpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf
SCOPe Domain Coordinates for d4ubpc2:
Click to download the PDB-style file with coordinates for d4ubpc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ubpc2:
- d4ubpc2 first appeared (with stable ids) in SCOP 1.55
- d4ubpc2 appears in SCOPe 2.04
- d4ubpc2 appears in SCOPe 2.06
- d4ubpc2 appears in the current release, SCOPe 2.08
View in 3D
