Lineage for d3wtwb_ (3wtw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803033Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
    barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices
  4. 2803034Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) (S)
    automatically mapped to Pfam PF02312
  5. 2803035Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins)
  6. 2803049Protein automated matches [259048] (1 species)
    not a true protein
  7. 2803050Species Mouse (Mus musculus) [TaxId:10090] [259049] (7 PDB entries)
  8. 2803063Domain d3wtwb_: 3wtw B: [259146]
    Other proteins in same PDB: d3wtwa_, d3wtwc_, d3wtwf_
    automated match to d2jhba_
    protein/DNA complex

Details for d3wtwb_

PDB Entry: 3wtw (more details), 2.9 Å

PDB Description: crystal structure of the complex comprised of ets1(k167a), runx1, cbfbeta, and the tcralpha gene enhancer dna
PDB Compounds: (B:) Core-binding factor subunit beta

SCOPe Domain Sequences for d3wtwb_:

Sequence, based on SEQRES records: (download)

>d3wtwb_ b.54.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldg
mgclefdeeraqqedalaq

Sequence, based on observed residues (ATOM records): (download)

>d3wtwb_ b.54.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpapsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmgclefdee
raqqedalaq

SCOPe Domain Coordinates for d3wtwb_:

Click to download the PDB-style file with coordinates for d3wtwb_.
(The format of our PDB-style files is described here.)

Timeline for d3wtwb_: